PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011416-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 310aa    MW: 34843.1 Da    PI: 4.9563
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011416-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg WT++Ed +++ +v ++G+g+W++++++ g++R++k+c++rw +yl
  WALNUT_00011416-RA 14 RGLWTAQEDAKILAYVSKHGTGNWTAVPKKAGLKRCGKSCRLRWTNYL 61
                        788*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.976965IPR017930Myb domain
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
SuperFamilySSF466892.34E-211687IPR009057Homeodomain-like
CDDcd001676.84E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.1E-66586IPR009057Homeodomain-like
SMARTSM007177566176IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MVRPPCCDKL NLKRGLWTAQ EDAKILAYVS KHGTGNWTAV PKKAGLKRCG KSCRLRWTNY  60
LRPDLKHDSF TPQEEEMIVR LHAAIGSSRI GSLNKDFKNV TMLKSEPYPF PPQGFPNISS  120
QLVPSTTSPQ TTPIQLDTFF NSNQANNNHS FDLLAELQTI KLVTEVSNCS HNNTHPPPIF  180
LEDSLSSSSS SSPTCSTAAQ EKSPLDLSWH DFLLDDEFLP ADPQEQEIMA SHSSKEFASQ  240
NQNVIVQKNE TNKEAAIEEC IKAKGTDCEI LSNDFQPSSS SEISFVEAML DQEYRMFLDF  300
PNLLEEPFYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-131187479B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321544.12e-99hypothetical protein POPTR_0015s07900g
TrEMBLB9IEI52e-99B9IEI5_POPTR; Uncharacterized protein
STRINGPOPTR_0015s07900.15e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-47MYB family protein